PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_44733
Common NameKK1_044806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 511aa    MW: 56909 Da    PI: 8.7516
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_44733genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.3e-1561107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+ Ede l +av  +  ++Wk+Ia+ ++  Rt+ qc +rwqk+l
    C.cajan_44733  61 KGGWTAAEDETLRKAVSAFNAKNWKKIAEFFP-DRTEVQCLHRWQKVL 107
                      688*****************************.************986 PP

2Myb_DNA-binding62.11.1e-19113159148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+++v++v  +G+  W++Ia+ ++ gR +kqc++rw+++l
    C.cajan_44733 113 KGPWTQEEDDKIVELVSIHGPTKWSLIAKSLP-GRIGKQCRERWHNHL 159
                      79******************************.*************97 PP

3Myb_DNA-binding50.54.7e-16165208146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT eE++ l da++ +G++ W+ Ia+ +  gRt++ +k++w++
    C.cajan_44733 165 KDAWTFEEELALMDAHRIYGNK-WAEIAKVLH-GRTDNAIKNHWNS 208
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.74856107IPR017930Myb domain
SMARTSM007171.4E-1460109IPR001005SANT/Myb domain
PfamPF002495.6E-1461107IPR001005SANT/Myb domain
SuperFamilySSF466891.58E-1562117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-2263115IPR009057Homeodomain-like
CDDcd001673.32E-1264107No hitNo description
PROSITE profilePS5129432.569108163IPR017930Myb domain
SuperFamilySSF466896.74E-31110206IPR009057Homeodomain-like
SMARTSM007175.9E-18112161IPR001005SANT/Myb domain
PfamPF002491.5E-18113159IPR001005SANT/Myb domain
CDDcd001672.49E-15115159No hitNo description
Gene3DG3DSA:1.10.10.609.6E-28116162IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-22163214IPR009057Homeodomain-like
PROSITE profilePS5129420.533164214IPR017930Myb domain
SMARTSM007173.3E-15164212IPR001005SANT/Myb domain
PfamPF002494.4E-14165208IPR001005SANT/Myb domain
CDDcd001674.87E-11167210No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MAEEKSEQCW MDKEQTNVAS GSSVSEAKDN DNVMLISSRK CSPGSALPSN RRTTGPVRRA  60
KGGWTAAEDE TLRKAVSAFN AKNWKKIAEF FPDRTEVQCL HRWQKVLNPE LVKGPWTQEE  120
DDKIVELVSI HGPTKWSLIA KSLPGRIGKQ CRERWHNHLN PDIKKDAWTF EEELALMDAH  180
RIYGNKWAEI AKVLHGRTDN AIKNHWNSSL KKKMDSYLDT GKLPSTPKYS AQVAVKDTVS  240
HSTFNTIHVC SNKGLDDSIA SLSKTTDISK QDNSDKNQLE SSGTVREVGD SSNVPANESH  300
DSDCIKCNGS SNKALICSNA KVVSGDNLGI NSEPKFENPV LNGNPTTDHY MNKDSNLHFN  360
IPGLQNDLFS SPMLSPVGFL TPPPVKGIEL SPESPESILK KAAKTFPTPS ILRKRRNRVQ  420
NPVTPSKVAK ELHAYTERER TNDNFGSEVV SLSLSLACHS YESNIPHNTA FSATPPYRLR  480
SKQTTIKSLE KELESAVDKE KPEKLQRGVL W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-68602145159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-68602145159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529095.10.0PREDICTED: myb-like protein A
TrEMBLA0A151QVG50.0A0A151QVG5_CAJCA; Myb-related protein 3R-1
STRINGGLYMA07G15820.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-128myb domain protein 3r-5